Recombinant Psychromonas ingrahamii ATP synthase subunit b(atpF)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Psychromonas ingrahamii (strain 37) Uniprot NO.: A1T0Z3 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MNINATLLGQAIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAK ASEKLKEAKVQAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREEL RLKVSALAIAGAEKIIKRSIDKEANSDIIDKLVAEL Protein Names: Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b Gene Names: Name: atpF Ordered Locus Names: Ping_3734 Expression Region: 1-156 Sequence Info: full length protein