Recombinant Mouse Secretory carrier-associated membrane protein 3(Scamp3)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Mus musculus (Mouse) Uniprot NO.: O35609 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MAQSRDTGNPFPDSGELDNPFQDPAVIQHRPSQQYATLDVYNPFENREPPPAYEPPAPAP APLPPPSAPSVQSSRKLSPTEPRNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRER ELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLAL LLNFFACLARFCVDTGSGSGFGLSMLWLLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFF IFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLK RIHSLYRQTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP Protein Names: Recommended name: Secretory carrier-associated membrane protein 3 Short name= Secretory carrier membrane protein 3 Gene Names: Name: Scamp3 Expression Region: 1-349 Sequence Info: Full length protein