Recombinant Bovine Mitochondrial import receptor subunit TOM22 homolog(TOMM22)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Bos taurus (Bovine) Uniprot NO.: A6QPI6 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MAAAAAGPGAPLSADELLPKGDAEKPEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Protein Names: Recommended name: Mitochondrial import receptor subunit TOM22 homolog Alternative name(s): Translocase of outer membrane 22 kDa subunit homolog Gene Names: Name: TOMM22 Expression Region: 1-140 Sequence Info: full length protein