Recombinant Enterobacteria phage lambda Superinfection exclusion protein B(sieB)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Enterobacteria phage lambda (Bacteriophage lambda) Uniprot NO.: P03762 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MMSIEMDPLVILGRVFSNEPLERTMYMIVIWVGLLLLSPDNWPEYVNERIGIPHVWHVFV FALAFSLAINVHRLSAIASARYKRFKLRKRIKMQNDKVRSVIQNLTEEQSMVLCAALNEG RKYVVTSKQFPYISELIELGVLNKTFSRWNGKHILFPIEDIYWTELVASYDPYNIEIKPR PISK Protein Names: Recommended name: Superinfection exclusion protein B Gene Names: Name: sieB Synonyms: git Expression Region: 1-184 Sequence Info: full length protein