Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF12(ORF12)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Spodoptera frugiperda ascovirus 1a (SfAV-1a) Uniprot NO.: Q0E589 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MMSSVTSEIIHTDVSGQRVRPPLTYCNGELGLKNSEDAAYFCLEKFKSFNEVPDFQYIYL TLSLHVPPPTRKYLLKFHKRLLNVCRLCGETGDLVGGRVLVSGVSQKTADIVVSAKSNGE VLYDWSNFFKSTVRVRCRYTIAKLYNNKAAMREIAKQKNWQTTYPNLEAYRKLNDAAKNS KHTPIVSIQTPPPPAPTPNRPDVPASKNVVITQRYQKPVEKIEDSRLETTRISVIPLLSV LLLVIIIILL Protein Names: Recommended name: Uncharacterized protein ORF12 Gene Names: ORF Names: ORF12 Expression Region: 1-250 Sequence Info: full length protein