Skip to Content

Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein E(crlE)

https://www.neural-circuits.org/web/image/product.template/124108/image_1920?unique=cd3f829
Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Dictyostelium discoideum (Slime mold) Uniprot NO.: Q54LY7 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MLSLSSYVLNLVGSILCLIGCLFIIGHFFWIPLLRTSLSRIIIYPTFILLLYDMVSFPSF ISKTADLYIERSTIICNFQEAIIQYLILSNFIWSVCISVNLLYLCFSPNKNLKKNELLYH LCSWGIPLIVVVITKIPNMISDNGNQCRFKSPNYIKFYLETILFIAFMLFNFIVAFITIK HIISGNLRESETTTTSVLFVNEKKITTKKIVWRLLLYPSILSICYIMTLVLSIYQFSTES YGSGGAYANSINNKRNDKNTESGNSNNNNNSYIEILLYISKAIFLLQGFFNALVYLRSSK LRDRYKKITIFRKIFWRDEADYQSINDGFN Protein Names: Recommended name: Cyclic AMP receptor-like protein E Gene Names: Name: crlE ORF Names: DDB_G0286301 Expression Region: 1-330 Sequence Info: full length protein

1,211.76 1211.76 USD 1,211.76

1,211.76

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days