Skip to Content

Recombinant Pongo abelii Peroxisomal membrane protein 11B(PEX11B)

https://www.neural-circuits.org/web/image/product.template/150066/image_1920?unique=5670230
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Pongo abelii (Sumatran orangutan) Uniprot NO.: Q5RFI0 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MDAWVRFSAQSQARERLCRAAQYACSLLGHVLQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GHLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP Protein Names: Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Peroxisomal biogenesis factor 11B Protein PEX11 homolog beta Short name= PEX11-beta Gene Names: Name: PEX11B Expression Region: 1-259 Sequence Info: full length protein

1,157.76 1157.76 USD 1,157.76

1,157.76

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days