Recombinant Human Voltage-gated hydrogen channel 1(HVCN1)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Homo sapiens (Human) Uniprot NO.: Q96D96 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPT PVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAEL ILDLKIIQPDKNNYAAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVV SFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQMNVQLAA KIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN Protein Names: Recommended name: Voltage-gated hydrogen channel 1 Alternative name(s): Hydrogen voltage-gated channel 1 Short name= HV1 Voltage sensor domain-only protein Gene Names: Name: HVCN1 Synonyms: VSOP ORF Names: UNQ578/PRO1140 Expression Region: 1-273 Sequence Info: full length protein