Recombinant Pseudomonas putida Ubiquinol oxidase subunit 2(cyoA)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Pseudomonas putida (Arthrobacter siderocapsulatus) Uniprot NO.: Q9WWR1 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: CNWTLLDPKGQVGIEQKNLILIATGLMLLVVIPVIIMTVVFAWKYRASNKAATYTPDWSH STKIEAAVWIIPILIIIALGYFTYHSTHKLDPYRPLDSDVKPVQIDVVALDWKWLFIYPE QGIATVNKIVFPANTPVNFRVTSDAVMNSFFIPGLGGQIYAMAGMTTKLHLIANENGEFD GISANYSGAGFTGMKFKATATSQEDFDKWVAEVKQSPKKLDKAEYEALAKPSENNPVALY SEASPDQFQLIVDKYEGMNRGRPSHEEAGSKDLATTKGVESSMQPAAGAEE Protein Names: Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome o subunit 2 Cytochrome o ubiquinol oxidase subunit 2 Oxidase BO(3) subunit 2 Ubiquinol oxidase polypeptide II Gene Names: Name: cyoA Expression Region: 24-314 Sequence Info: full length protein