Recombinant Mouse Myoglobin(Mb)

>Several Other Sizes Are Also Available. Please Inquire. Default Volume: 200ug Updated Date: Stock Protein updated on 20170725 Research areas: Cardiovascular Target / Protein: Mb Biologically active: Not Tested Expression system: Yeast Species of origin: Mus musculus (Mouse) Delivery time: 3-7 business days Uniprot ID: P04247 AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged Expression Region: 2-154aa Protein length: Full Length MW: 18.9 kDa Alternative Name(s): Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159: 469-474(1986) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.